PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KHN48693.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family Dof
Protein Properties Length: 473aa    MW: 52156.1 Da    PI: 6.8278
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KHN48693.1genomeTCUHKView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof1252.4e-39121181262
      zf-Dof   2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62 
                 ++k l+cprC+s++tkfCyynny+++qPryfCkaC+ryWt+GG++rnvPvG+grrknk+s+
  KHN48693.1 121 PDKVLPCPRCKSMDTKFCYYNNYNVNQPRYFCKACQRYWTAGGTMRNVPVGAGRRKNKNST 181
                 78999*****************************************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074784.0E-29114178IPR003851Zinc finger, Dof-type
PfamPF027013.2E-32122179IPR003851Zinc finger, Dof-type
PROSITE profilePS5088428.537125179IPR003851Zinc finger, Dof-type
PROSITE patternPS013610127163IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 473 aa     Download sequence    Send to blast
MHEIRDPAIR LFGQKIPFPE DVVVDKEEKE IESGEEREQE MEKYEDQGHK DAGVENVTEE  60
ELEVDPPPNA EETKNSGSSP EAIVNPKTPS IEEETEKSKG DKTEKEQGDA ANSQEKTLKK  120
PDKVLPCPRC KSMDTKFCYY NNYNVNQPRY FCKACQRYWT AGGTMRNVPV GAGRRKNKNS  180
TSHYRHITIS EALQAARIDS HLPPLKGNGR VLSFGLDAHA PICDSMASVN NLGEKKPLNC  240
TRNGFHHGFE DQRLPPVPCK SGENGDDSST TSSITVSSSK GENNKNTFQQ QSVPQNHGFL  300
PQLPCIPGVS WPYTWNSPVP PPAMCPSGFP LPFYPATFWN CGMPGNWNVP LFSSHSSASN  360
LESRSSSPNS PTLGKHSRDG DMIKQYSLPK EEASKPRNGG VLVPKTLRID DPSEAAKSSI  420
WATLGIKNES VSGGGMFKAF QSKKNEKNHV EASPLLMANP AALSRSLNFH ENS
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00394DAPTransfer from AT3G47500Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0939480.0BT093948.1 Soybean clone JCVI-FLGm-24D21 unknown mRNA.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003524761.10.0PREDICTED: cyclic dof factor 3-like
SwissprotQ8LFV31e-125CDF3_ARATH; Cyclic dof factor 3
TrEMBLA0A0B2SUT50.0A0A0B2SUT5_GLYSO; Dof zinc finger protein DOF3.3
TrEMBLI1JZN70.0I1JZN7_SOYBN; Uncharacterized protein
STRINGGLYMA05G00970.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF62534147
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G47500.11e-113cycling DOF factor 3
Publications ? help Back to Top
  1. Qi X, et al.
    Identification of a novel salt tolerance gene in wild soybean by whole-genome sequencing.
    Nat Commun, 2014. 5: p. 4340
    [PMID:25004933]